PDB entry 6fi0

View 6fi0 on RCSB PDB site
Description: Crystal structure of BAZ2A PHD zinc finger in complex with Fr 19
Class: transcription
Keywords: TRANSCRIPTION, PHD zinc finger, bromodomain, BAZ2A, fragment, Fr 19, Fr19, epigenetic, ligandability
Deposited on 2018-01-16, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fi0a_
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fi0b_
  • Chain 'C':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fi0c_
  • Chain 'D':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fi0d_
  • Heterogens: ZN, PO4, K, DEW, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fi0A (A:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fi0A (A:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fi0B (B:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fi0B (B:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvcla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fi0C (C:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fi0C (C:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fi0D (D:)
    hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fi0D (D:)
    kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv