PDB entry 6fhu

View 6fhu on RCSB PDB site
Description: crystal structure of baz2a phd zinc finger in complex with h3 3-mer peptide
Deposited on 2018-01-15, released 2018-03-21
The last revision was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ala-arg-tam
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FHU (0-2)
  • Chain 'G':
    Compound: ala-arg-tam
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FHU (0-2)
  • Chain 'H':
    Compound: ala-arg-tam
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FHU (0-2)
  • Heterogens: ZN, PO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fhuA (A:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

    Sequence, based on observed residues (ATOM records):
    >6fhuA (A:)
vtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fhuB (B:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

    Sequence, based on observed residues (ATOM records):
    >6fhuB (B:)
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaq

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6fhuC (C:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

    Sequence, based on observed residues (ATOM records):
    >6fhuC (C:)
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqq

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6fhuD (D:)
hmsvnkvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

    Sequence, based on observed residues (ATOM records):
    >6fhuD (D:)
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >6fhuF (F:)
arx

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6fhuG (G:)
arx

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6fhuH (H:)
arx