PDB entry 6fhq

View 6fhq on RCSB PDB site
Description: Crystal structure of human BAZ2B PHD zinc finger in complex with Fr 21
Class: transcription
Keywords: TRANSCRIPTION, PHD, zinc finger, BAZ2B, BAZ2A, bromodomain, fragment, competition, epigenetic
Deposited on 2018-01-15, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-57)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6fhqa1, d6fhqa2
  • Chain 'B':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-57)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6fhqb1, d6fhqb2
  • Heterogens: ZN, DE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fhqA (A:)
hmsimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fhqB (B:)
hmsimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas