PDB entry 6fhp

View 6fhp on RCSB PDB site
Description: DAIP in complex with a C-terminal fragment of thermolysin
Class: antimicrobial protein
Keywords: Dispase autolysis-inducing protein; neutral metalloproteases; protease twisting; conformation analysis, ANTIMICROBIAL PROTEIN
Deposited on 2018-01-15, released 2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dispase autolysis-inducing protein
  Species: Streptomyces mobaraensis [TaxId:35621]
  Gene: daip
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84908 (0-341)
• Chain 'B':
  Compound: dispase autolysis-inducing protein
  Species: Streptomyces mobaraensis [TaxId:35621]
  Gene: daip
  Database cross-references and differences (RAF-indexed):
  • Uniprot P84908 (0-341)
• Chain 'C':
  Compound: thermolysin
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43133
  Domains in SCOPe 2.08: d6fhpc_
• Chain 'D':
  Compound: thermolysin
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P43133 (0-61)
  Domains in SCOPe 2.08: d6fhpd_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6fhpC (C:)
  vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
  vk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6fhpC (C:)
  gigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavgv
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6fhpD (D:)
  vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
  vk