PDB entry 6fhm

View 6fhm on RCSB PDB site
Description: Crystal structure of the F47E mutant of the lipoprotein localization factor, LolA
Class: protein transport
Keywords: Lipoprotein transport, domain-swapped dimer, PROTEIN TRANSPORT
Deposited on 2018-01-15, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.3899999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lolA, lplA, yzzV, b0891, JW0874
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61316 (24-205)
      • expression tag (13-23)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d6fhma1, d6fhma2
  • Chain 'B':
    Compound: Outer-membrane lipoprotein carrier protein
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: lolA, lplA, yzzV, b0891, JW0874
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61316 (24-205)
      • expression tag (21-23)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d6fhmb1, d6fhmb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fhmA (A:)
    mgsshhhhhhssglvprgshmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegq
    gdlwvkrpnlenwhmtqpdesilvsdgktlwfynpfveqatatwlkdatgntpfmliarn
    qssdwqqynikqngddfvltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlks
    qqngavdaakftftppqgvtvddqrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhmA (A:)
    lvprgshmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlenw
    hmtqpdesilvsdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqn
    gddfvltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftf
    tppqgvtvddqrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fhmB (B:)
    mgsshhhhhhssglvprgshmasmdaasdlksrldkvssfhasftqkvtdgsgaavqegq
    gdlwvkrpnlenwhmtqpdesilvsdgktlwfynpfveqatatwlkdatgntpfmliarn
    qssdwqqynikqngddfvltpkasngnlkqftinvgrdgtihqfsaveqddqrssyqlks
    qqngavdaakftftppqgvtvddqrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhmB (B:)
    asmdaasdlksrldkvssfhasftqkvtdgsgaavqegqgdlwvkrpnlenwhmtqpdes
    ilvsdgktlwfynpfveqatatwlkdatgntpfmliarnqssdwqqynikqngddfvltp
    kasngnlkqftinvgrdgtihqfsaveqddqrssyqlksqqngavdaakftftppqgvtv
    ddqrk