PDB entry 6fhk

View 6fhk on RCSB PDB site
Description: Structure of a modified protein containing a genetically encoded phosphoserine
Class: chaperone
Keywords: Chaperone, phosphoserine, ADP
Deposited on 2018-01-14, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock 70 kda protein 1a
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA1A, HSP72, HSPA1, HSX70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fhka1, d6fhka2
  • Chain 'B':
    Compound: heat shock 70 kda protein 1a
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA1A, HSP72, HSPA1, HSX70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fhkb1, d6fhkb2
  • Heterogens: SEP, ADP, PO4, MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fhkA (A:)
    makaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    lnpqnsvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeis
    smvltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaa
    iaygldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnh
    fveefkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitra
    rfeelcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdln
    ksinpdeavaygaavqaailm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhkA (A:)
    aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
    qnsvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
    ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
    gldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfve
    efkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfe
    elcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksi
    npdeavaygaavqaailm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fhkB (B:)
    makaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    lnpqnsvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeis
    smvltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaa
    iaygldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnh
    fveefkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitra
    rfeelcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdln
    ksinpdeavaygaavqaailm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhkB (B:)
    aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
    qnsvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
    ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
    gldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfve
    efkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfe
    elcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksi
    npdeavaygaavqaailm