PDB entry 6fhf

View 6fhf on RCSB PDB site
Description: Highly active enzymes by automated modular backbone assembly and sequence design
Class: Artificial enzyme
Keywords: Design, ARTIFICIAL ENZYME
Deposited on 2018-01-14, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Design
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FHF (Start-361)
    Domains in SCOPe 2.07: d6fhfa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fhfA (A:)
    tigsefkphisalnapslaqrykdyfyigaavepyqttkekdakmlqrhfnmivaenamk
    paaleptegnfqwadadrivqfakengmelrfhtlvwhnqtpdwffldregkpmveetdp
    qkreenrelllqrlenhiravvlrykddiknwdvvnevvepndpggmrnspwyqitgtey
    ievafraareaggediklymndynteqepkreyiyrlikkllekgvpidgvghqahvtid
    rppvdeikktiqrfadlgldnqiteldvslygwpprpayptydaipeerfqaqadryrql
    felfeelkdhisavtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpaywaiin
    hk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhfA (A:)
    gsefkphisalnapslaqrykdyfyigaavepyqttkekdakmlqrhfnmivaenamkpa
    aleptegnfqwadadrivqfakengmelrfhtlvwhnqtpdwffldregkpmveetdpqk
    reenrelllqrlenhiravvlrykddiknwdvvnevvepndpggmrnspwyqitgteyie
    vafraareaggediklymndynteqepkreyiyrlikkllekgvpidgvghqahvtidrp
    pvdeikktiqrfadlgldnqiteldvslygwpprpayptydaipeerfqaqadryrqlfe
    lfeelkdhisavtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpaywaiinhk