PDB entry 6fha

View 6fha on RCSB PDB site
Description: Death-associated Protein Kinase 1 (DAPK1) catalytic and auto-regulatory domains with S289A and S308A mutations
Class: signaling protein
Keywords: kinase, apoptosis, autophagy, CaMK, SIGNALING PROTEIN
Deposited on 2018-01-12, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK1, DAPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355
      • engineered mutation (291)
    Domains in SCOPe 2.07: d6fhaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fhaA (A:)
    gpmatvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvs
    redierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeat
    eflkqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefkni
    fgtpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefe
    deyfsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkaaavnmekfk
    kfaarkkwkqavrlislcqrlsrsflsrsnmsvarsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhaA (A:)
    frqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredier
    evsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflkqi
    lngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpef
    vapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsn
    tsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalsrkaaavnmekfkkfaar