PDB entry 6fh8

View 6fh8 on RCSB PDB site
Description: E. coli surface display of streptavidin for directed evolution of an allylic deallocase
Class: biotin binding protein
Keywords: biotin binding protein, artificial metalloenzyme, E. coli surface display, streptavidin, biotin, bioorthogonal reaction, uncaging, allyl deprotection, directed evolution
Deposited on 2018-01-12, released 2018-08-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (9-12)
      • engineered mutation (111)
      • engineered mutation (120)
    Domains in SCOPe 2.08: d6fh8a1, d6fh8a2
  • Heterogens: JCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6fh8A (A:)
masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltmgtteanaw
astlvghdtftkvkpsaasidaakkagvnngnpldavqq

    Sequence, based on observed residues (ATOM records): (download) 
    >6fh8A (A:)
mgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgs
gtalgwtvawknnyrnahsattwsgqyvggaearintqwlltmgtteanawastlvghdt
ftkvk