PDB entry 6fh6

View 6fh6 on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with 1-methylpyridinone compound 1
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2018-01-12, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6fh6a1, d6fh6a2
  • Heterogens: D8Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fh6A (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fh6A (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk