PDB entry 6fh5

View 6fh5 on RCSB PDB site
Description: PI3Kg IN COMPLEX WITH Compound 7
Class: transferase
Keywords: Kinase, inhibitor, complex, TRANSFERASE
Deposited on 2018-01-12, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fh5a1, d6fh5a2, d6fh5a3
  • Heterogens: DD8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fh5A (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fh5A (A:)
    esqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtsk
    plpeylwkkianncifivihrttsqtikvspddtpgailqdfvlrvcgrdeylvgetpik
    nfqwvrhclkngeeihvvldtppdpaldevrkvslwdcdrkfrvkirgidipvtvfvean
    iqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycqllyyvnllli
    dhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnychpialpkraempn
    qlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyq
    llarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkf
    epyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtaml
    hdftqqvqviemlqkvtldikslsassqvisqlkqklenlqnlpesfrvpydpglkagal
    aiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwe
    tesldlcllpygcistgdkigmieivkdattiakiqqkdevlnhwlkekspteekfqaav
    erfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfvltpdflfvmgts
    gtsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmkedieyirdaltvgkneedak
    kyfldqievcrdkgwtvqfnwf