PDB entry 6fgo

View 6fgo on RCSB PDB site
Description: Fc in complex with engineered calcium binding domain Z
Class: immune system
Keywords: Antibody, Protein A, EF-hand, calcium-binding, IMMUNE SYSTEM
Deposited on 2018-01-11, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5 (0-End)
      • conflict (119)
      • conflict (121)
  • Chain 'B':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5 (0-End)
      • conflict (119)
      • conflict (121)
  • Chain 'C':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5 (0-End)
      • conflict (119)
      • conflict (121)
  • Chain 'D':
    Compound: Immunoglobulin gamma-1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0DOX5 (0-End)
      • conflict (119)
      • conflict (121)
  • Chain 'E':
    Compound: Z-Ca
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FGO
    Domains in SCOPe 2.07: d6fgoe_
  • Chain 'F':
    Compound: Z-Ca
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FGO (0-End)
    Domains in SCOPe 2.07: d6fgof_
  • Chain 'G':
    Compound: Z-Ca
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FGO
    Domains in SCOPe 2.07: d6fgog_
  • Chain 'H':
    Compound: Z-Ca
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FGO
    Domains in SCOPe 2.07: d6fgoh_
  • Heterogens: NAG, BMA, MAN, FUC, PEG, GOL, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fgoE (E:)
    vdnklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeak
    klndarapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgoE (E:)
    nklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeakkl
    ndar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fgoF (F:)
    vdnklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeak
    klndarapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgoF (F:)
    vdnklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeak
    klndara
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fgoG (G:)
    vdnklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeak
    klndarapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgoG (G:)
    klnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeakkln
    darap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fgoH (H:)
    vdnklnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeak
    klndarapk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgoH (H:)
    lnkeqqnafyeilhlpnlneeqrkafiqslidgggdtngngyldaeesanllaeakklnd
    arap