PDB entry 6fgn

View 6fgn on RCSB PDB site
Description: solution structure of p300taz2-p63ta
Deposited on 2018-01-11, released 2018-05-30
The last revision was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase p300,Tumor protein 63
    Species: Homo sapiens [TaxId:9606]
    Gene: TP63, KET, P63, P73H, P73L, TP73L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q09472 (0-89)
      • conflict (15)
      • conflict (23)
      • conflict (66-67)
      • linker (90-96)
    • Uniprot Q9H3D4 (97-123)
      • conflict (117)
  • Heterogens: ZN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fgnA (A:)
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqkgtiegrgneflspevfqhiwdfleqpissv
qpid