PDB entry 6fgh
View 6fgh on RCSB PDB site
Description: Crystal Structure of BAZ2A bromodomain in complex with 3-amino-2-methylpyridine derivative 1
Class: transcription
Keywords: four helical bundle, transcription
Deposited on
2018-01-10, released
2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated
2018-05-30, with a file datestamp of
2018-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2A
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2A, KIAA0314, TIP5
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d6fgha_ - Heterogens: 6RZ, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>6fghA (A:)
mshsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
sseefaadallvfdncqtfneddsevgkaghimrrffesrweefy
Sequence, based on observed residues (ATOM records): (download)
>6fghA (A:)
hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytss
eefaadallvfdncqtfneddsevgkaghimrrffesrweefy