PDB entry 6fgf

View 6fgf on RCSB PDB site
Description: Crystal Structure of BAZ2A bromodomain in complex with 1-methylpyridinone compound 2
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2018-01-10, released 2018-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2A
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2A, KIAA0314, TIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fgfa_
  • Heterogens: EN2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fgfA (A:)
    smhsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggyt
    sseefaadallvfdncqtfneddsevgkaghimrrffesrweefy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgfA (A:)
    hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytss
    eefaadallvfdncqtfneddsevgkaghimrrffesrweefy