PDB entry 6fga

View 6fga on RCSB PDB site
Description: Crystal structure of TRIM21 E3 ligase, RING domain in complex with its cognate E2 conjugating enzyme UBE2E1
Class: ligase
Keywords: RING-type E3 ligase, UBC core domain and Ubiquitination, LIGASE
Deposited on 2018-01-10, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: e3 ubiquitin-protein ligase trim21
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM21, RNF81, RO52, SSA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgai_
  • Chain 'J':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgaj_
  • Chain 'K':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgak_
  • Chain 'L':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgal_
  • Chain 'M':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgam_
  • Chain 'N':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgan_
  • Chain 'O':
    Compound: Ubiquitin-conjugating enzyme E2 E1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2E1, UBCH6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgao_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6fgaI (I:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaI (I:)
    llstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvfflditft
    peypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpad
    plvgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6fgaJ (J:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaJ (J:)
    msknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvff
    lditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsllt
    dcnpadplvgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6fgaK (K:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaK (K:)
    kllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvfflditf
    tpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpa
    dplvgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fgaL (L:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaL (L:)
    stsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvfflditftpe
    ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
    vgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6fgaM (M:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaM (M:)
    llstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvfflditft
    peypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpad
    plvgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6fgaN (N:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaN (N:)
    skllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvffldit
    ftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnp
    adplvgsiatqymtnraehdrmarqwtkryat
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6fgaO (O:)
    gsmsknskllstsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggv
    fflditftpeypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicsl
    ltdcnpadplvgsiatqymtnraehdrmarqwtkryat
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgaO (O:)
    stsakriqkeladitldpppncsagpkgdniyewrstilgppgsvyeggvfflditftpe
    ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
    vgsiatqymtnraehdrmarqwtkryat