PDB entry 6fg9

View 6fg9 on RCSB PDB site
Description: mouse sorcs2 ectodomain (sortilin related vps10 domain containing receptor 2)
Deposited on 2018-01-10, released 2018-08-01
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VPS10 domain-containing receptor SorCS2
    Species: Mus musculus [TaxId:10090]
    Gene: Sorcs2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EPR5
      • conflict (137)
  • Chain 'B':
    Compound: VPS10 domain-containing receptor SorCS2
    Species: Mus musculus [TaxId:10090]
    Gene: Sorcs2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EPR5
      • conflict (137)
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fg9A (A:)
    garavpvagaasasraqvslistsfvlkgdathnqamvhwtgenssvililtkyyhadmg
    kvlesslwrssdfgttytkltlqpgvttvidnfyicpankrkiilvssslgdreqslfls
    tdegatfqkypvpflvetllfhpkeedkvlaytkdsklyvssdlgkkwtllqervtkdhv
    fwavsgvdddpnlvhveaqdlsggyryytcliyncsaqphiapfsgpidrgsltvqdeyi
    flkatstnrtkyyvsyrrsdfvlmklpkyalpkdlqiistdeqqvfvavqewnqvdtynl
    yqsdlrgvryslvlenvrssrqaeenvvidilevrgvkgvflanqkvdgkvttvitynkg
    rdwdylrppstdmngkptncqppdcylhlhlrwadnpyvsgtvhtkdtapglimgagnlg
    sqlveykeemyitsdcghtwrqvfeeehhvlyldhggviaaikdtsiplkilkfsvdegh
    twsthnftstsvfvdgllsepgdetlvmtvfghisfrsdwelvkvdfrpsfprqcgeddy
    sswdltdlqgdhcimgqqrsyrkrkstswcvkgrsftsaltsrvckcrdsdflcdygfer
    ssssestankcsanfwfnplsppedcvlgqtytsslgyrkvvsnvceggvdlqqspvqlq
    cplqaprglqvsirgeavavrpredvlfvvrqeqgdvlttkyqvdlgdgfkamyvnltlt
    gepirhhyespgiyrvsvraenmaghdeavlfvqvnsplqalylevvpvigvnqevnlta
    vllplnpnltvfywwighslqpllsldnsvttkftdagdvrvtvqaacgnsvlqdsrlvr
    vldqfqvvplrfsreldtfnpntpewredvglvvtrllsketsipeellvtvvkpglpti
    adlyvllplprptrkrsltsdkrlaavqqalnshrisfilrgglrilvelrdtdtgpqrp
    ggsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fg9A (A:)
    qvslistsfvlkgdathnqamvhwtgenssvililtkyyhadmgkvlesslwrssdfgtt
    ytkltlqpgvttvidnfyicpakiilvssslgdreqslflstdegatfqkypvpflvetl
    lfhpkeedkvlaytkdsklyvssdlgkkwtllqervtkdhvfwavsgvdddpnlvhveaq
    dlsggyryytcliyncsaqphiapfsgpidrgsltvqdeyiflkatstnrtkyyvsyrrs
    dfvlmklpkyalpkdlqiistdeqqvfvavqewnqvdtynlyqsdlrgvryslvlenvrs
    srqaeenvvidilevrgvkgvflanqkvdgkvttvitynkgrdwdylrppstdmngkptn
    cqppdcylhlhlrwadnvhtkdtapglimgagnlgsqlveykeemyitsdcghtwrqvfe
    eehhvlyldhggviaaikdtsiplkilkfsvdeghtwsthnftstsvfvdgllseptlvm
    tvfghisfrsdwelvkvdfrpsfprqcgeddysswdltdlqgdhcimgqqrsyrkrksts
    wcvkgrsftsaltsrvckcrdsdflcdygferssssestankcsanfwfnplsppedcvl
    gqtytsslgyrkvvsnvceggvdlqqspvqlqcplqaprglqvsirgeavavrpredvlf
    vvrqeqgdvlttkyqvdlgdgfkamyvnltltgepirhhyespgiyrvsvraenmaghde
    avlfvqvnsplqalylevvpvigvnqevnltavllplnpnltvfywwighslqpllsldn
    svttkftdagdvrvtvqaacgnsvlqdsrlvrvldqfqvvplrfsreldtfnpntpewre
    dvglvvtrllsketsipeellvtvvkpglptiadlyvllpltsdkrlaavqqalnshris
    filrgglrilvelrd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fg9B (B:)
    garavpvagaasasraqvslistsfvlkgdathnqamvhwtgenssvililtkyyhadmg
    kvlesslwrssdfgttytkltlqpgvttvidnfyicpankrkiilvssslgdreqslfls
    tdegatfqkypvpflvetllfhpkeedkvlaytkdsklyvssdlgkkwtllqervtkdhv
    fwavsgvdddpnlvhveaqdlsggyryytcliyncsaqphiapfsgpidrgsltvqdeyi
    flkatstnrtkyyvsyrrsdfvlmklpkyalpkdlqiistdeqqvfvavqewnqvdtynl
    yqsdlrgvryslvlenvrssrqaeenvvidilevrgvkgvflanqkvdgkvttvitynkg
    rdwdylrppstdmngkptncqppdcylhlhlrwadnpyvsgtvhtkdtapglimgagnlg
    sqlveykeemyitsdcghtwrqvfeeehhvlyldhggviaaikdtsiplkilkfsvdegh
    twsthnftstsvfvdgllsepgdetlvmtvfghisfrsdwelvkvdfrpsfprqcgeddy
    sswdltdlqgdhcimgqqrsyrkrkstswcvkgrsftsaltsrvckcrdsdflcdygfer
    ssssestankcsanfwfnplsppedcvlgqtytsslgyrkvvsnvceggvdlqqspvqlq
    cplqaprglqvsirgeavavrpredvlfvvrqeqgdvlttkyqvdlgdgfkamyvnltlt
    gepirhhyespgiyrvsvraenmaghdeavlfvqvnsplqalylevvpvigvnqevnlta
    vllplnpnltvfywwighslqpllsldnsvttkftdagdvrvtvqaacgnsvlqdsrlvr
    vldqfqvvplrfsreldtfnpntpewredvglvvtrllsketsipeellvtvvkpglpti
    adlyvllplprptrkrsltsdkrlaavqqalnshrisfilrgglrilvelrdtdtgpqrp
    ggsaaahhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6fg9B (B:)
    qvslistsfvlkgdathnqamvhwtgenssvililtkyyhadmgkvlesslwrssdfgtt
    ytkltlqpgvttvidnfyicpakiilvssslgdreqslflstdegatfqkypvpflvetl
    lfhpkeedkvlaytkdsklyvssdlgkkwtllqervtkdhvfwavsgvdddpnlvhveaq
    dlsggyryytcliyncsiapfsgpidrgsltvqdeyiflkatstnrtkyyvsyrrsdfvl
    mklpkyalpkdlqiistdeqqvfvavqewnqvdtynlyqsdlrgvryslvlenvrssrqa
    eenvvidilevrgvkgvflanqkvdgkvttvitynkgrdwdylrppstdmngkptncqpp
    dcylhlhlrwadnpyvsgtvhtkdtapglimgagnlgsqlveykeemyitsdcghtwrqv
    feeehhvlyldhggviaaikdtsiplkilkfsvdeghtwsthnftstsvfvdgllsepgd
    etlvmtvfghisfrsdwelvkvdfrpsfprqcgeddysswdltdlqgdhcimgqqrsyrk
    rkstswcvkgrsftsaltsrvckcrdsdflcdygferssssestkcsanfwfnplspped
    cvlgqtytsslgyrkvvsnvceggvdlqqspvqlqcplqaprglqvsirgeavavrpred
    vlfvvrqeqgdvlttkyqvdlgdgfkamyvnltltgepirhhyespgiyrvsvraenmag
    hdeavlfvqvnsplqalylevvpvigvnqevnltavllplnpnltvfywwighslqplls
    ldnsvttkftdagdvrvtvqaacgnsvlqdsrlvrvldqfqvvplrfsreldtfnpntpe
    wredvglvvtrllsketsipeellvtvvkpglptiadlyvllpltsdkrlaavqqalnsh
    risfilrgglrilvelrd