PDB entry 6fg2

View 6fg2 on RCSB PDB site
Description: crystal structure of fab of natalizumab in complex with fab of naa84.
Class: immune system
Keywords: antibody, immune system
Deposited on 2018-01-09, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: heavy chain fab naa84
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2
  • Chain 'E':
    Compound: light chain fab naa84
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2
    Domains in SCOPe 2.07: d6fg2e1, d6fg2e2
  • Chain 'F':
    Compound: heavy chain fab naa84
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2
  • Chain 'G':
    Compound: light chain fab naa84
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2
    Domains in SCOPe 2.07: d6fg2g1, d6fg2g2
  • Chain 'H':
    Compound: heavy chain fab natalizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2 (0-End)
  • Chain 'I':
    Compound: heavy chain fab natalizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2 (0-End)
  • Chain 'L':
    Compound: light chain fab natalizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2 (0-210)
    Domains in SCOPe 2.07: d6fg2l1, d6fg2l2
  • Chain 'M':
    Compound: light chain fab natalizumab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG2 (0-210)
    Domains in SCOPe 2.07: d6fg2m1, d6fg2m2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fg2E (E:)
    sseltqdpavsvalgqtvritcqgdslrsnyaswyqqkpgqapllviygknyrpsgipdr
    fsgsysgntasltisgaqaedeadyycnsrdssgdhpvvfgggtnltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fg2E (E:)
    seltqdpavsvalgqtvritcqgdslrsnyaswyqqkpgqapllviygknyrpsgipdrf
    sgsysgntasltisgaqaedeadyycnsrdssgdhpvvfgggtnltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fg2G (G:)
    sseltqdpavsvalgqtvritcqgdslrsnyaswyqqkpgqapllviygknyrpsgipdr
    fsgsysgntasltisgaqaedeadyycnsrdssgdhpvvfgggtnltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fg2G (G:)
    seltqdpavsvalgqtvritcqgdslrsnyaswyqqkpgqapllviygknyrpsgipdrf
    sgsysgntasltisgaqaedeadyycnsrdssgdhpvvfgggtnltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fg2L (L:)
    diqmtqspsslsasvgdrvtitcktsqdinkymawyqqtpgkaprllihytsalqpgips
    rfsgsgsgrdytftisslqpediatyyclqydnlwtfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fg2M (M:)
    diqmtqspsslsasvgdrvtitcktsqdinkymawyqqtpgkaprllihytsalqpgips
    rfsgsgsgrdytftisslqpediatyyclqydnlwtfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg