PDB entry 6ffu

View 6ffu on RCSB PDB site
Description: solution nmr structure of cbm64 from s.thermophila using 20% 13c, 100% 15n
Deposited on 2018-01-09, released 2019-01-30
The last revision was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase family 5 cellulase CBM64
    Species: Spirochaeta thermophila [TaxId:154]
    Gene: STHERM_c20620
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ffuA (A:)
sgeyteialpfsydgageyywktdqfstdpndwsryvnswnldlleingtdytnvwvaqh
qipaasdgywyihyksgvswghveik