PDB entry 6ffn

View 6ffn on RCSB PDB site
Description: Structure-based design and synthesis of macrocyclic human rhinovirus 3C protease inhibitors
Class: hydrolase
Keywords: 3C Protease, Rhinovirus, Inhibitor, HYDROLASE
Deposited on 2018-01-08, released 2018-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C protease
    Species: Human rhinovirus 2 [TaxId:12130]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04936 (2-181)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6ffna1, d6ffna2
  • Heterogens: D8K, SO4, DMS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ffnA (A:)
    gsgpeeefgmslikhnscvittengkftglgvydrfvvvpthadpgkeiqvdgittkvid
    sydlynkngikleitvlkldrnekfrdirryipnneddypncnlallanqpeptiinvgd
    vvsygnillsgnqtarmlkysyptksgycggvlykigqvlgihvggngrdgfsamllrsy
    ft