PDB entry 6ffm

View 6ffm on RCSB PDB site
Description: Crystal Structure of Human KEAP1 BTB Domain in Complex with isoxazoline-based inhibitor
Class: signaling protein
Keywords: 3-bromo-4 5-dihydroisoxazole, BTB domain, antioxidant response, Signaling protein
Deposited on 2018-01-08, released 2018-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kelch-like ECH-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KEAP1, INRF2, KIAA0132, KLHL19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14145 (Start-135)
      • engineered mutation (127)
    Domains in SCOPe 2.08: d6ffma_
  • Heterogens: D8N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6ffmA (A:)
ghmgnrtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlasss
pvfkamftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqi
dsvvracadflvqqld

    Sequence, based on observed residues (ATOM records): (download) 
    >6ffmA (A:)
rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka
mftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvr
acadflvqqld