PDB entry 6ffj

View 6ffj on RCSB PDB site
Description: Anti-tumor antibody 14F7-derived single chain fragment variable (scFv)
Class: antitumor protein
Keywords: ganglioside, scfv, antibody fragment, single chain fragment variable, immuno therapy, 14F7, ANTITUMOR PROTEIN, gm3
Deposited on 2018-01-08, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14F7-derived scFv
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FFJ (0-End)
    Domains in SCOPe 2.07: d6ffja1, d6ffja2, d6ffja3
  • Chain 'C':
    Compound: 14F7-derived scFv
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FFJ (0-252)
    Domains in SCOPe 2.07: d6ffjc1, d6ffjc2, d6ffjc3
  • Chain 'E':
    Compound: 14F7-derived scFv
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FFJ (0-252)
    Domains in SCOPe 2.07: d6ffje1, d6ffje2, d6ffje3
  • Chain 'G':
    Compound: 14F7-derived scFv
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FFJ (Start-252)
    Domains in SCOPe 2.07: d6ffjg1, d6ffjg2, d6ffjg3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ffjA (A:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssklsgsasapkleegefsearvdiqmtqtpsslsaslgdrvtiscrasqdisnyln
    wyqqkpdgtvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqgntl
    pptfgagtklelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ffjA (A:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssvdiqmtqtpsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrl
    hsgvpsrfsgsgsgtdysltisnleqediatyfcqqgntlpptfgagtklel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ffjC (C:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssklsgsasapkleegefsearvdiqmtqtpsslsaslgdrvtiscrasqdisnyln
    wyqqkpdgtvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqgntl
    pptfgagtklelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ffjC (C:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssvdiqmtqtpsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrl
    hsgvpsrfsgsgsgtdysltisnleqediatyfcqqgntlpptfgagtklelk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ffjE (E:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssklsgsasapkleegefsearvdiqmtqtpsslsaslgdrvtiscrasqdisnyln
    wyqqkpdgtvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqgntl
    pptfgagtklelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ffjE (E:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycarespyyyamdywgqgttvtvsvd
    iqmtqtpsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvpsr
    fsgsgsgtdysltisnleqediatyfcqqgntlpptfgagtklelk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ffjG (G:)
    qvqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
    nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
    vtvssklsgsasapkleegefsearvdiqmtqtpsslsaslgdrvtiscrasqdisnyln
    wyqqkpdgtvklliyytsrlhsgvpsrfsgsgsgtdysltisnleqediatyfcqqgntl
    pptfgagtklelk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ffjG (G:)
    vqlqqsgaelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytesn
    qkfkdkailtadrssntafmylnsltsedsavyycarespryyyamdywgqgttvtvssd
    iqmtqtpsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvpsr
    fsgsgsgtdysltisnleqediatyfcqqgntlpptfgagtklelk