PDB entry 6ffg

View 6ffg on RCSB PDB site
Description: Human BRD2 C-terminal bromodomain with (S)-1-(2-cyclopropyl-4-(2-(hydroxymethyl)benzyl)-6-(1,2,3,6-tetrahydropyridin-4-yl)-3,4-dihydroquinoxalin-1(2H)-yl)ethanone
Class: transcription
Keywords: inhibitor, histone, epigenetic reader, bromodomain, brd4, bromodomain containing protein 4, antagonist, transcription
Deposited on 2018-01-07, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, KIAA9001, RING3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25440 (3-114)
    • expression tag (2)
  Domains in SCOPe 2.08: d6ffga1, d6ffga2
• Heterogens: EDO, D7B, PEG, MES, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ffgA (A:)
  gsmgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvk
  rkmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ffgA (A:)
  mgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrk
  menrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd