PDB entry 6ffe

View 6ffe on RCSB PDB site
Description: Human BRD2 C-terminal bromodomain with 2-((4-acetyl-3-cyclopropyl-3,4-dihydroquinoxalin-1(2H)-yl)methyl)benzoic acid
Class: transcription
Keywords: inhibitor, histone, epigenetic reader, bromodomain, brd4, bromodomain containing protein 4, antagonist, transcription
Deposited on 2018-01-07, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (3-114)
      • expression tag (2)
    Domains in SCOPe 2.08: d6ffea1, d6ffea2
  • Heterogens: PEG, EDO, D7Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ffeA (A:)
    gsmgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvk
    rkmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ffeA (A:)
    mgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrk
    menrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd