PDB entry 6ffe
View 6ffe on RCSB PDB site
Description: Human BRD2 C-terminal bromodomain with 2-((4-acetyl-3-cyclopropyl-3,4-dihydroquinoxalin-1(2H)-yl)methyl)benzoic acid
Class: transcription
Keywords: inhibitor, histone, epigenetic reader, bromodomain, brd4, bromodomain containing protein 4, antagonist, transcription
Deposited on
2018-01-07, released
2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-02-12, with a file datestamp of
2020-02-07.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain-containing protein 2
Species: Homo sapiens [TaxId:9606]
Gene: BRD2, KIAA9001, RING3
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d6ffea1, d6ffea2 - Heterogens: PEG, EDO, D7Q, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>6ffeA (A:)
gsmgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvk
rkmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
Sequence, based on observed residues (ATOM records): (download)
>6ffeA (A:)
mgklseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrk
menrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd