PDB entry 6ffd

View 6ffd on RCSB PDB site
Description: Human BRD4 C-terminal bromodomain with 1-(4-(3-methylbenzyl)-3,4-dihydroquinoxalin-1(2H)-yl)ethanone
Class: transcription
Keywords: inhibitor, histone, epigenetic reader, bromodomain, brd4, bromodomain containing protein 4, antagonist, transcription
Deposited on 2018-01-06, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 4
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD4, HUNK1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60885 (0-End)
  Domains in SCOPe 2.08: d6ffda_
• Heterogens: D7T, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6ffdA (A:)
  sskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksk
  leareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpdepee
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6ffdA (A:)
  sskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstiksk
  leareyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd