PDB entry 6ff9

View 6ff9 on RCSB PDB site
Description: Mutant R280K of human P53
Class: DNA binding protein
Keywords: p53, mutant, DNA binding, anticancer therapy, DNA BINDING PROTEIN
Deposited on 2018-01-04, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-192)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6ff9a_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-192)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6ff9b_
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-192)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6ff9c_
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: TP53, P53
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637 (0-192)
      • engineered mutation (183)
    Domains in SCOPe 2.07: d6ff9d_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ff9A (A:)
    vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
    vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
    vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgkdrrteeenl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ff9B (B:)
    vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
    vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
    vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgkdrrteeenl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ff9C (C:)
    vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
    vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
    vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgkdrrteeenl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ff9D (D:)
    vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
    vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
    vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgkdrrteeenl