PDB entry 6ff8

View 6ff8 on RCSB PDB site
Description: Crystal structure of uncomplexed Rab32 in the active GTP-bound state at 2.13 Angstrom resolution
Class: signaling protein
Keywords: small GTPase, Rab, GTP, vesicle trafficking, cell dynamics, SIGNALING PROTEIN
Deposited on 2018-01-04, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related protein rab-32
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB32
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13637 (2-180)
      • conflict (67)
    Domains in SCOPe 2.07: d6ff8a_
  • Chain 'B':
    Compound: ras-related protein rab-32
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB32
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13637 (2-End)
      • conflict (67)
    Domains in SCOPe 2.07: d6ff8b_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ff8A (A:)
    smetrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrl
    qlwdiaglerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspip
    avllankcdqnkdssqspsqvdqfckehgfagwfetsakdninieeaarflvekilvnhq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ff8A (A:)
    etrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlql
    wdiaglerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspipav
    llankcdqsqspsqvdqfckehgfagwfetsakdninieeaarflvekilvnhqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ff8B (B:)
    smetrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrl
    qlwdiaglerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspip
    avllankcdqnkdssqspsqvdqfckehgfagwfetsakdninieeaarflvekilvnhq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ff8B (B:)
    etrehlfkvlvigelgvgktsiikryvhqlfsqhyratigvdfalkvlnwdsrtlvrlql
    wdiaglerfgnmtrvyykeavgafvvfdisrsstfeavlkwksdldskvhlpngspipav
    llankcdspsqvdqfckehgfagwfetsakdninieeaarflvekilvnh