PDB entry 6ff5

View 6ff5 on RCSB PDB site
Description: X-ray structure of bovine heart cytochrome c at high ionic strength
Class: electron transport
Keywords: cytochrome c, ELECTRON TRANSPORT
Deposited on 2018-01-03, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ff5a_
  • Heterogens: HEC, NO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ff5A (A:)
    gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgfsytdanknkgitwg
    eetlmeylenpkkyipgtkmifagikkkgeredliaylkkatne