PDB entry 6ff2

View 6ff2 on RCSB PDB site
Description: CopZ metallochaperone
Class: chaperone
Keywords: metallochaperone, copper, copper homeostasis, staphylococcus aureus, chaperone
Deposited on 2018-01-03, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper chaperone copZ
    Species: Staphylococcus aureus (strain NCTC 8325) [TaxId:93061]
    Gene: copZ, SAOUHSC_02874
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ff2a_
  • Chain 'B':
    Compound: Copper chaperone copZ
    Species: Staphylococcus aureus (strain NCTC 8325) [TaxId:93061]
    Gene: copZ, SAOUHSC_02874
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ff2b_
  • Heterogens: CU1, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ff2A (A:)
    msqeilnvegmscghcksavesalnnidgvtsadvnlengqvsvqyddskvavsqmkdai
    edqgydvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ff2A (A:)
    sqeilnvegmscghcksavesalnnidgvtsadvnlengqvsvqyddskvavsqmkdaie
    dqgydvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ff2B (B:)
    msqeilnvegmscghcksavesalnnidgvtsadvnlengqvsvqyddskvavsqmkdai
    edqgydvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ff2B (B:)
    sqeilnvegmscghcksavesalnnidgvtsadvnlengqvsvqyddskvavsqmkdaie
    dqgydvv