PDB entry 6ff1

View 6ff1 on RCSB PDB site
Description: csoz metallochaperone
Deposited on 2018-01-03, released 2019-01-30
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CsoZ
    Species: Staphylococcus aureus (strain NCTC 8325) [TaxId:93061]
    Gene: SAOUHSC_02321
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ff1A (A:)
    mihqntiytagieteeqvsqlterisnmigvhqvniniidgqvtvsyetpanlnsiekei
    ydegykivf