PDB entry 6fei

View 6fei on RCSB PDB site
Description: Phosphotriesterase PTE_A53_1
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-01-02, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FEI
    Domains in SCOPe 2.07: d6feia_
  • Chain 'B':
    Compound: hydrolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FEI (0-336)
    Domains in SCOPe 2.07: d6feib_
  • Heterogens: FMT, ZN, D6K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6feiA (A:)
    iseigdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrr
    araagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqf
    flreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdg
    eqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasas
    allgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafip
    lrvipflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6feiA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraag
    vrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflrei
    qygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallgn
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgvpqetlagitvtnparflspt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6feiB (B:)
    isefigdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglr
    raraagvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltq
    fflreiqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrd
    geqqaaifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasa
    sallgnrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafi
    plrvipflrekgvpqetlagitvtnparflsptlras