PDB entry 6fee

View 6fee on RCSB PDB site
Description: Phosphotriesterase PTE_A53_1
Class: hydrolase
Keywords: Metalloenzyme, TIM barrel, hydrolase
Deposited on 2018-01-02, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FEE
    Domains in SCOPe 2.07: d6feea_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6feeA (A:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraa
    gvrtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflre
    iqygiedtgiragiikvatqgkatpfqelvlraaaraslatgvpvtthtfasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldgiphsaiglednasasallg
    nrswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvi
    pflrekgvpqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >6feeA (A:)
    rintvrgpitiseagftlthehicgssagflrawpeffgsraalvekavrglrraraagv
    rtivdvstfdagrdvsllaevsraadvhivaatglwedpplsmrlrsveeltqfflreiq
    ygiedtgiragiikvatqgatpfqelvlraaaraslatgvpvtthteqqaaifeseglsp
    srvcighsddtddlsyltalaargyligldswqtrallikalidqgymkqilvsndwlfg
    fssyvtninpdgmafiplrvipflrekgvpqetlagitvtnparflsptl