PDB entry 6fdz

View 6fdz on RCSB PDB site
Description: Unc-51-Like Kinase 3 (ULK3) In Complex With Momelotinib
Class: transferase
Keywords: Kinase Inhibitor DFG-out, transferase
Deposited on 2017-12-27, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: Serine/threonine-protein kinase ULK3
    Species: Homo sapiens [TaxId:9606]
    Gene: ULK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdzu_
  • Heterogens: C87, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6fdzU (U:)
    agpgwgpprldgfilterlgsgtyatvykayakkdtrevvaikcvakkslnkasvenllt
    eieilkgirhphivqlkdfqwdsdniylimefcaggdlsrfihtrrilpekvarvfmqql
    asalqflhernishldlkpqnillsslekphlkladfgfaqhmspwdekhvlrgsplyma
    pemvcqrqydarvdlwsmgvilyealfgqppfasrsfseleekirsnrvielplrpllsr
    dcrdllqrllerdpsrrisfqdffahpwvdlehmps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdzU (U:)
    pprldgfilterlgsgtyatvykayakkdtrevvaikcvakkslnkasvenllteieilk
    girhphivqlkdfqwdsdniylimefcaggdlsrfihtrrilpekvarvfmqqlasalqf
    lhernishldlkpqnillsslekphlkladfgfaqhmspwdekhvlrgsplymapemvcq
    ydarvdlwsmgvilyealfgqppfasrsfseleekirsnrvielplrpllsrdcrdllqr
    llerdpsrrisfqdffahpwvdleh