PDB entry 6fdy

View 6fdy on RCSB PDB site
Description: Unc-51-Like Kinase 3 (ULK3) In Complex With Bosutinib
Class: transferase
Keywords: Kinase Inhibitor DFG-in, transferase
Deposited on 2017-12-27, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: Serine/threonine-protein kinase ULK3
    Species: Homo sapiens [TaxId:9606]
    Gene: ULK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdyu_
  • Heterogens: DB8, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6fdyU (U:)
    agpgwgpprldgfilterlgsgtyatvykayakkdtrevvaikcvakkslnkasvenllt
    eieilkgirhphivqlkdfqwdsdniylimefcaggdlsrfihtrrilpekvarvfmqql
    asalqflhernishldlkpqnillsslekphlkladfgfaqhmspwdekhvlrgsplyma
    pemvcqrqydarvdlwsmgvilyealfgqppfasrsfseleekirsnrvielplrpllsr
    dcrdllqrllerdpsrrisfqdffahpwvdlehmps
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdyU (U:)
    prldgfilterlgatvykayakkdtrevvaikcvakkslnkasvenllteieilkgirhp
    hivqlkdfqwdsdniylimefcaggdlsrfihtrrilpekvarvfmqqlasalqflhern
    ishldlkpqnillsslekphlkladfgfaqhmspwdekhvlrgsplymapemvcqrqyda
    rvdlwsmgvilyealfgqppfasrsfseleekirsnrvielplrpllsrdcrdllqrlle
    rdpsrrisfqdffahpwvdleh