PDB entry 6fdt

View 6fdt on RCSB PDB site
Description: NMR structure of the second TPR domain of the human RPAP3 protein in complex with HSP70 peptide SGPTIEEVD
Class: chaperone
Keywords: TPR HSP RUVBL Polymerase, chaperone
Deposited on 2017-12-26, released 2018-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase II-associated protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RPAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H6T3 (4-119)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6fdta1, d6fdta2
  • Chain 'B':
    Compound: Heat shock 70 kDa protein 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA1B, HSP72
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fdtA (A:)
gphmqaisekdrgngffkegkyeraiecytrgiaadganallpanramaylkiqkyeeae
kdctqailldgsyskafarrgtartflgklneakqdfetvlllepgnkqavtelskikkk

  • Chain 'B':
    No sequence available.