PDB entry 6fdr

View 6fdr on RCSB PDB site
Description: 7-fe ferredoxin from azotobacter vinelandii at 100k, na dithionite reduced at ph 8.5, resolution 1.4 a
Class: electron transport
Keywords: electron transport, iron-sulfur
Deposited on 1998-12-11, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (7-fe ferredoxin I)
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdra_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fdrA (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler