PDB entry 6fdg

View 6fdg on RCSB PDB site
Description: novel crystal structure of dhna-coa thioesterase from staphylococcus aureus
Deposited on 2017-12-22, released 2018-02-21
The last revision was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AB520_06685, ERS072840_02738
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AB520_06685, ERS072840_02738
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AB520_06685, ERS072840_02738
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 4-hydroxybenzoyl-CoA Thioesterase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AB520_06685, ERS072840_02738
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6fdgA (A:)
    miysiteiearyaetdkmgviyhgnyatwfevarldyisklgfsyadmekqgiispvtdl
    nvnykksifypekvkvktwvekysrlrsvykyeifnekgelattgstelicikedtfkpi
    rldryfpdwheayskvqalnnegkiveimdgidsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fdgB (B:)
    miysiteiearyaetdkmgviyhgnyatwfevarldyisklgfsyadmekqgiispvtdl
    nvnykksifypekvkvktwvekysrlrsvykyeifnekgelattgstelicikedtfkpi
    rldryfpdwheayskvqalnnegkiveimdgidsl
    

    Sequence, based on observed residues (ATOM records):
    >6fdgB (B:)
    miysiteiearyaetdkmgviyhgnyatwfevarldyisklgfsyadmekqgiispvtdl
    nvnykksifypekvkvktwvekysrlrsvykyeifnekgelattgstelicikedtfkpi
    rldryfpdwheayskvqalnnegkiveim
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6fdgC (C:)
    miysiteiearyaetdkmgviyhgnyatwfevarldyisklgfsyadmekqgiispvtdl
    nvnykksifypekvkvktwvekysrlrsvykyeifnekgelattgstelicikedtfkpi
    rldryfpdwheayskvqalnnegkiveimdgidsl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6fdgD (D:)
    miysiteiearyaetdkmgviyhgnyatwfevarldyisklgfsyadmekqgiispvtdl
    nvnykksifypekvkvktwvekysrlrsvykyeifnekgelattgstelicikedtfkpi
    rldryfpdwheayskvqalnnegkiveimdgidsl
    

    Sequence, based on observed residues (ATOM records):
    >6fdgD (D:)
    miysiteiearyaetdkmgviyhgnyatwfevarldyisklgfsyadmekqgiispvtdl
    nvnykksifypekvkvktwvekysrlrsvykyeifnekgelattgstelicikedtfkpi
    rldryfpdwheayskvqalnnegkiveim