PDB entry 6fdf

View 6fdf on RCSB PDB site
Description: Crystal structure of S. pombe Dnmt2 methyltransferase
Class: transferase
Keywords: Dnmt2, Methyltransferase, S-adenosylhomocysteine, tRNA, TRANSFERASE
Deposited on 2017-12-22, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (cytosine(38)-C(5))-methyltransferase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: pmt1, SPBC19C2.02
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdfa_
  • Chain 'B':
    Compound: tRNA (cytosine(38)-C(5))-methyltransferase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: pmt1, SPBC19C2.02
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdfb_
  • Chain 'C':
    Compound: tRNA (cytosine(38)-C(5))-methyltransferase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: pmt1, SPBC19C2.02
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdfc_
  • Chain 'D':
    Compound: tRNA (cytosine(38)-C(5))-methyltransferase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: pmt1, SPBC19C2.02
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdfd_
  • Heterogens: SAH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fdfA (A:)
    gplgslstkrlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakh
    mdistltakdfdafdcklwtmspscqpftrignrkdildprsqaflnilnvlphvnnlpe
    yilienvqgfeeskaaeecrkvlrncgynliegilspnqfnipnsrsrwyglarlnfkge
    wsiddvfqfsevaqkegevkrirdyleierdwssymvlesvlnkwghqfdivkpdssscc
    cftrgythlvqgagsilqmsdhentheqfernrmalqlryftarevarlmgfpeslewsk
    snvtekcmyrllgnsinvkvvsylisllleplnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdfA (A:)
    rlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakhmdistltak
    dfdafdcklwtmspscqpftrignrkdildprsqaflnilnvlphvnnlpeyilienvqg
    feeskaaeecrkvlrncgynliegilspnqfnipnsrsrwyglarlnfkgewsiddvfqf
    sevaqkegevkrirdyleierdwssymvlesvlnkwghqfdivkpdssscccftrgythl
    vqgagsilqmsdhentheqfernrmalqlryftarevarlmgfpeslewsksnvtekcmy
    rllgnsinvkvvsylisllleplnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fdfB (B:)
    gplgslstkrlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakh
    mdistltakdfdafdcklwtmspscqpftrignrkdildprsqaflnilnvlphvnnlpe
    yilienvqgfeeskaaeecrkvlrncgynliegilspnqfnipnsrsrwyglarlnfkge
    wsiddvfqfsevaqkegevkrirdyleierdwssymvlesvlnkwghqfdivkpdssscc
    cftrgythlvqgagsilqmsdhentheqfernrmalqlryftarevarlmgfpeslewsk
    snvtekcmyrllgnsinvkvvsylisllleplnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdfB (B:)
    krlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakhmdistlta
    kdfdafdcklwtmspscqpftriprsqaflnilnvlphvnnlpeyilienvqgfeeskaa
    eecrkvlrncgynliegilspnqfnipnsrsrwyglarlnfkgewsiddvfqfsevaqke
    gevkrirdyleierdwssymvlesvlnkwghqfdivkpdssscccftrgythlvqgagsi
    lqmsdhentheqfernrmalqlryftarevarlmgfpeslewsksnvtekcmyrllgnsi
    nvkvvsylisllleplnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fdfC (C:)
    gplgslstkrlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakh
    mdistltakdfdafdcklwtmspscqpftrignrkdildprsqaflnilnvlphvnnlpe
    yilienvqgfeeskaaeecrkvlrncgynliegilspnqfnipnsrsrwyglarlnfkge
    wsiddvfqfsevaqkegevkrirdyleierdwssymvlesvlnkwghqfdivkpdssscc
    cftrgythlvqgagsilqmsdhentheqfernrmalqlryftarevarlmgfpeslewsk
    snvtekcmyrllgnsinvkvvsylisllleplnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdfC (C:)
    rlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakhmdistltak
    dfdafdcklwtmspscqpprsqaflnilnvlphvnnlpeyilienvqgfeeskaaeecrk
    vlrncgynliegilspnqfnipnsrsrwyglarlnfkgewsiddvfqfsevaqkegevkr
    irdyleierdwssymvlesvlnkwghqfdivkpdssscccftrgythlvqgagsilqmsd
    hentheqfernrmalqlryftarevarlmgfpeslewsksnvtekcmyrllgnsinvkvv
    sylisllleplnf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fdfD (D:)
    gplgslstkrlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakh
    mdistltakdfdafdcklwtmspscqpftrignrkdildprsqaflnilnvlphvnnlpe
    yilienvqgfeeskaaeecrkvlrncgynliegilspnqfnipnsrsrwyglarlnfkge
    wsiddvfqfsevaqkegevkrirdyleierdwssymvlesvlnkwghqfdivkpdssscc
    cftrgythlvqgagsilqmsdhentheqfernrmalqlryftarevarlmgfpeslewsk
    snvtekcmyrllgnsinvkvvsylisllleplnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdfD (D:)
    rlrvlelysgiggmhyalnlanipadivcaidinpqaneiynlnhgklakhmdistltak
    dfdafdcklwtmspscqpftdprsqaflnilnvlphvnnlpeyilienvqgfeeskaaee
    crkvlrncgynliegilspnqfnipnsrsrwyglarlnfkgewsiddvfqfsevegevkr
    irdyleierdwssymvlesvlnkwghqfdivkpdssscccftrgythlvqgagsilqmsd
    hentheqfernrmalqlryftarevarlmgfpeslewsksnvtekcmyrllgnsinvkvv
    sylisllleplnf