PDB entry 6fde

View 6fde on RCSB PDB site
Description: crystal structure of the hhd2 domain of whirlin : 3-helix conformation
Deposited on 2017-12-22, released 2018-08-08
The last revision was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Whirlin
    Species: Mus musculus [TaxId:10090]
    Gene: Whrn, Dfnb31, Kiaa1526
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fdeA (A:)
gamgsgnqtrallddqarhllteqeratmmyylaqyrggtisveamvmalfellnthakf
sllsevrsiispqdldrfdhlvlrr

    Sequence, based on observed residues (ATOM records):
    >6fdeA (A:)
arhllteqeratmmyylaqyrggtisveamvmalfellnthakfsllsevrsiispqdld
rfdhlvlr