PDB entry 6fd6

View 6fd6 on RCSB PDB site
Description: Crystal Structure of Human APRT-Tyr105Phe variant in complex with Adenine, PRPP and Mg2+, 30 days post crystallization (with AMP and PPi products fully generated)
Class: transferase
Keywords: Rossman fold, transferase
Deposited on 2017-12-21, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07741 (0-177)
      • conflict (102)
    Domains in SCOPe 2.08: d6fd6a_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07741 (0-177)
      • conflict (102)
    Domains in SCOPe 2.08: d6fd6b_
  • Heterogens: AMP, PPV, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fd6A (A:)
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslefgkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6fd6B (B:)
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslefgkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye