PDB entry 6fd5

View 6fd5 on RCSB PDB site
Description: Crystal Structure of Human APRT-Tyr105Phe variant in complex with Adenine, PRPP and Mg2+, 14 days post crystallization (with AMP and PPi products partially generated)
Class: transferase
Keywords: rossman fold, transferase
Deposited on 2017-12-21, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fd5a_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fd5b_
  • Heterogens: AMP, PPV, MG, GOL, PRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fd5A (A:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslefgkaeleiqkdalepgqr
    vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fd5A (A:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysaeleiqkdalepgqrvvvvd
    dllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fd5B (B:)
    dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
    gldsrgflfgpslaqelglgcvlirkrgklpgptlwasyslefgkaeleiqkdalepgqr
    vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fd5B (B:)
    selqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyiag
    ldsrgflfgpslaqelglgcvlirkrgklpgptlwasyaeleiqkdalepgqrvvvvddl
    latggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye