PDB entry 6fcy

View 6fcy on RCSB PDB site
Description: Catalytic subunit HisG from Psychrobacter arcticus ATP phosphoribosyltransferase (HisZG ATPPRT) in complex with PRPP and ADP
Class: transferase
Keywords: phosphoribosyltransferase, HisG, catalytic, cold-adapted, TRANSFERASE
Deposited on 2017-12-21, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: hisG, Psyc_1903
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fcya_
  • Heterogens: PRP, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fcyA (A:)
    gmtevtnslptsgllneandeflgltlalskgrileetmpllraagvelledpeasrkli
    fptsnpnvrvlilrasdvptyvehgaadfgvagkdvllehganhvyelldlkiaqcklmt
    agvkdaplpnrrlriatkyvnvarayfasqgqqvdviklygsmelaplvglgdlivdvvd
    tgntlrangleardhicdvssrlivnqvsykrkfallepildsfknsinsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fcyA (A:)
    flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty
    vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn
    varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss
    rlivnqvsykrkfallepildsfknsin