PDB entry 6fct

View 6fct on RCSB PDB site
Description: Catalytic subunit HisG from Psychrobacter arcticus ATP phosphoribosyltransferase (HisZG ATPPRT) in complex with PRPP and ATP
Class: transferase
Keywords: phosphoribosyltransferase, HisG, catalytic, cold-adapted, TRANSFERASE
Deposited on 2017-12-21, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase
    Species: Psychrobacter arcticus (strain DSM 17307 / 273-4) [TaxId:259536]
    Gene: hisG, Psyc_1903
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fcta_
  • Heterogens: ATP, MG, PRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fctA (A:)
    gmtevtnslptsgllneandeflgltlalskgrileetmpllraagvelledpeasrkli
    fptsnpnvrvlilrasdvptyvehgaadfgvagkdvllehganhvyelldlkiaqcklmt
    agvkdaplpnrrlriatkyvnvarayfasqgqqvdviklygsmelaplvglgdlivdvvd
    tgntlrangleardhicdvssrlivnqvsykrkfallepildsfknsinsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fctA (A:)
    flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty
    vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn
    varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss
    rlivnqvsykrkfallepildsfknsins