PDB entry 6fci

View 6fci on RCSB PDB site
Description: Crystal Structure of Human APRT wild type in complex with Adenine, PRPP and Mg2+
Class: transferase
Keywords: Rossman fold, transferase
Deposited on 2017-12-20, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fcia_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fcib_
  • Chain 'C':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fcic_
  • Chain 'D':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fcid_
  • Heterogens: MG, PRP, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fciA (A:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fciB (B:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fciB (B:)
    selqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyiag
    ldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqrv
    vvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fciC (C:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fciD (D:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fciD (D:)
    selqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyiag
    ldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqrv
    vvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye