PDB entry 6fc6

View 6fc6 on RCSB PDB site
Description: bik1 cap-gly domain with etf peptide from bim1
Deposited on 2017-12-20, released 2018-04-11
The last revision was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear fusion protein BIK1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: BIK1, YCL029C, YCL29C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11709 (2-End)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Protein BIM1
    Species: Saccharomyces cerevisiae, synthetic [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6fc6A (A:)
gpmdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfq
teypqsglfiqlqkvasliekasisqtsrrttmeplsipknr

    Sequence, based on observed residues (ATOM records):
    >6fc6A (A:)
gpmdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfq
teypqsglfiqlqkvasliekas

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6fc6B (B:)
snnliideetf

    Sequence, based on observed residues (ATOM records):
    >6fc6B (B:)
etf