PDB entry 6fc5

View 6fc5 on RCSB PDB site
Description: Bik1 CAP-Gly domain
Class: cell cycle
Keywords: +TIP, CAP-Gly, microtubule, yeast, CELL CYCLE
Deposited on 2017-12-20, released 2018-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BIK1, SCKG_5419
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fc5a1, d6fc5a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6fc5A (A:)
gpmdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfq
teypqsglfiqlqkvasliekasisqtsrrttmeplsipknr

    Sequence, based on observed residues (ATOM records): (download) 
    >6fc5A (A:)
gpmdryqrkigcfiqipnlgrgqlkyvgpvdtkagmfagvdllanigkndgsfmgkkyfq
teypqsglfiqlqkvasliekasi