PDB entry 6fc3

View 6fc3 on RCSB PDB site
Description: Crystal structure of the eIF4E-p20 complex from Saccharomyces cerevisiae
Class: translation
Keywords: Translation Translational control Gene expression 4E-binding protein, TRANSLATION
Deposited on 2017-12-20, released 2018-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: eukaryotic translation initiation factor 4e
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: CDC33, TIF45, YOL139C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07260 (4-182)
    • engineered mutation (11)
    • engineered mutation (137)
    • engineered mutation (156)
  Domains in SCOPe 2.08: d6fc3a_
• Chain 'B':
  Compound: Cap-associated protein CAF20
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: CAF20, CAF2, CAP20, YOR276W, O5453W
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12962 (3-End)
    • expression tag (0-2)
• Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6fc3A (A:)
  gphmvkhplntawtlwytkpavdkseswsdllrpvtsfqtveefwaiiqnipephelplk
  sdyhvfrndvrpewedeanakggkwsfqlrgkgadidelwlrtllavigetideddsqin
  gvvlsirkggnkfalwtasedkepllriggkfkqvlaltddghleffphssangrhpqps
  itl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6fc3A (A:)
  vkhplntawtlwytkpavdkseswsdllrpvtsfqtveefwaiiqnipephelplksdyh
  vfrndvrpeeanakggkwsfqlrgkgadidelwlrtllavigetideqingvvlsirkgg
  nkfalwtasedkepllriggkfkqvlaltddghleffphssangrhpqpsitl
  

  
  
• Chain 'B':
  No sequence available.