PDB entry 6fc3

View 6fc3 on RCSB PDB site
Description: Crystal structure of the eIF4E-p20 complex from Saccharomyces cerevisiae
Class: translation
Keywords: Translation Translational control Gene expression 4E-binding protein, TRANSLATION
Deposited on 2017-12-20, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CDC33, TIF45, YOL139C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07260 (4-182)
      • engineered mutation (11)
      • engineered mutation (137)
      • engineered mutation (156)
    Domains in SCOPe 2.07: d6fc3a_
  • Chain 'B':
    Compound: Cap-associated protein CAF20
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CAF20, CAF2, CAP20, YOR276W, O5453W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12962 (3-End)
      • expression tag (0-2)
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fc3A (A:)
    gphmvkhplntawtlwytkpavdkseswsdllrpvtsfqtveefwaiiqnipephelplk
    sdyhvfrndvrpewedeanakggkwsfqlrgkgadidelwlrtllavigetideddsqin
    gvvlsirkggnkfalwtasedkepllriggkfkqvlaltddghleffphssangrhpqps
    itl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fc3A (A:)
    vkhplntawtlwytkpavdkseswsdllrpvtsfqtveefwaiiqnipephelplksdyh
    vfrndvrpeeanakggkwsfqlrgkgadidelwlrtllavigetideqingvvlsirkgg
    nkfalwtasedkepllriggkfkqvlaltddghleffphssangrhpqpsitl
    

  • Chain 'B':
    No sequence available.