PDB entry 6fc0

View 6fc0 on RCSB PDB site
Description: Crystal structure of the eIF4E-eIF4G complex from Chaetomium thermophilum
Class: translation
Keywords: Translation Translational control Translation initiation Gene expression, TRANSLATION
Deposited on 2017-12-20, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 4E-like protein
    Species: Chaetomium thermophilum var. thermophilum DSM 1495 [TaxId:759272]
    Gene: CTHT_0058450
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SCU4 (4-199)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6fc0a1, d6fc0a2
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 4G
    Species: Chaetomium thermophilum var. thermophilum DSM 1495 [TaxId:759272]
    Gene: CTHT_0071550
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fc0A (A:)
    gphmtvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynn
    iapvselavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaig
    etledeedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvef
    sghteaaqagstrakarmvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fc0A (A:)
    gphmtvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynn
    iapvselavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaig
    etledeedgevmgvvvnvrkgfyrigvwtrttekeilmnigrrlkevlklppnemvefsg
    hteaaqagrmvv
    

  • Chain 'B':
    No sequence available.