PDB entry 6fbz

View 6fbz on RCSB PDB site
Description: Crystal structure of the eIF4E-eIF4G complex from Chaetomium thermophilum in the cap-bound state
Class: translation
Keywords: Translation Translational control Translation initiation Gene expression, TRANSLATION
Deposited on 2017-12-20, released 2018-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Eukaryotic translation initiation factor 4E-like protein,Eukaryotic translation initiation factor 4E-like protein
  Species: Chaetomium thermophilum var. thermophilum DSM 1495 [TaxId:759272]
  Gene: CTHT_0058450
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SCU4 (4-151)
    • expression tag (1-3)
  • Uniprot G0SCU4 (152-199)
  Domains in SCOPe 2.08: d6fbza1, d6fbza2
• Chain 'B':
  Compound: Eukaryotic translation initiation factor 4G
  Species: Chaetomium thermophilum var. thermophilum DSM 1495 [TaxId:759272]
  Gene: CTHT_0071550
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SFP0 (4-80)
    • expression tag (3)
• Heterogens: MGP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6fbzA (A:)
  gphmtvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynn
  iapvselavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaig
  etledeedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvef
  sghteaaqagstrakarmvv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6fbzA (A:)
  phmtvfhdkenfnvkhplscrwtlwftkpasgkgdnwndllkkvitfesveefwgiynni
  apvselavksdyhlfkegvrpewedpqnkhggkwayqfkdkrsvnidelwlhtmlaaige
  tledeedgevmgvvvnvrkgfyrigvwtrttekskeilmnigrrlkevlklppnemvefs
  ghteaaqamvv
  

  
  
• Chain 'B':
  No sequence available.