PDB entry 6fbn

View 6fbn on RCSB PDB site
Description: Human Methionine Adenosyltransferase II mutant (Q113A)
Class: transferase
Keywords: transferase
Deposited on 2017-12-19, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-adenosylmethionine synthase isoform type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT2A, AMS2, MATA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31153 (Start-394)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d6fbna1, d6fbna2, d6fbna3
  • Chain 'B':
    Compound: S-adenosylmethionine synthase isoform type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAT2A, AMS2, MATA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31153 (Start-394)
      • engineered mutation (112)
    Domains in SCOPe 2.07: d6fbnb1, d6fbnb2, d6fbnb3
  • Heterogens: K, MG, PPK, SAM, PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fbnA (A:)
    mngqlngfheafieegtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetva
    ktgmillageitsraavdyqkvvreavkhigyddsskgfdyktcnvlvaleqaspdiaqg
    vhldrneedigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpds
    ktqvtvqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedt
    iyhlqpsgrfviggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarw
    vakslvkgglcrrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvi
    vrdldlkkpiyqrtaayghfgrdsfpwevpkklky
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fbnA (A:)
    egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr
    aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqaspdiaqgvhldrneedigagd
    qglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrga
    vlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlqpsgrfvigg
    pqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglcrrv
    lvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiyqrt
    aayghfgrdsfpwevpkklky
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fbnB (B:)
    mngqlngfheafieegtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetva
    ktgmillageitsraavdyqkvvreavkhigyddsskgfdyktcnvlvaleqaspdiaqg
    vhldrneedigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpds
    ktqvtvqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedt
    iyhlqpsgrfviggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarw
    vakslvkgglcrrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvi
    vrdldlkkpiyqrtaayghfgrdsfpwevpkklky
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fbnB (B:)
    gtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsra
    avdyqkvvreavkhigyddsskgfdyktcnvlvaleqaspddqglmfgyatdeteecmpl
    tivlahklnaklaelrrngtlpwlrpdsktqvtvqymqdrgavlpirvhtivisvqhdee
    vcldemrdalkekvikavvpakyldedtiyhlqpsgrfviggpqgdagltgrkiivdtyg
    gwgahgggafsgkdytkvdrsaayaarwvakslvkgglcrrvlvqvsyvshplsisifhy
    gtsqkserelleivkknfdlrpgvivrdldlkkpiyqrtaayghfgrdsfpwevpkklky